Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries) |
Domain d2cjuh_: 2cju H: [163422] automated match to d2uudh1 complexed with phx |
PDB Entry: 2cju (more details), 2.5 Å
SCOPe Domain Sequences for d2cjuh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjuh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evklvesggglvqpggslrlscatsgftftnyymnwvrqppgkalewlvsirnkangytt dysasvkgrftisrdnsqsilylemnnlraedsatyycargygygawfaywgqgtlvtvs a
Timeline for d2cjuh_: