Lineage for d2cjuh_ (2cju H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758513Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)
  8. 1758681Domain d2cjuh_: 2cju H: [163422]
    automated match to d2uudh1
    complexed with phx

Details for d2cjuh_

PDB Entry: 2cju (more details), 2.5 Å

PDB Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq16- 113.8 scfv in complex with phoxgaba
PDB Compounds: (H:) nq16-113.8 anti-phox antibody

SCOPe Domain Sequences for d2cjuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjuh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftftnyymnwvrqppgkalewlvsirnkangytt
dysasvkgrftisrdnsqsilylemnnlraedsatyycargygygawfaywgqgtlvtvs
a

SCOPe Domain Coordinates for d2cjuh_:

Click to download the PDB-style file with coordinates for d2cjuh_.
(The format of our PDB-style files is described here.)

Timeline for d2cjuh_: