Lineage for d2cjla_ (2cjl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533682Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2533683Protein automated matches [190563] (18 species)
    not a true protein
  7. 2533747Species Streptomyces coelicolor [TaxId:1902] [187551] (1 PDB entry)
  8. 2533748Domain d2cjla_: 2cjl A: [163420]
    automated match to d1cnsa_
    complexed with zn

Details for d2cjla_

PDB Entry: 2cjl (more details), 1.5 Å

PDB Description: crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences with plant enzymes
PDB Compounds: (A:) secreted chitinase

SCOPe Domain Sequences for d2cjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjla_ d.2.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
fvvseaqfdqmfpsrnsfytysgltaalsaypgfsntgsdtvkkqeaaaflanvghetgg
lvyvveqntanyphycdasqpygcpagndkyygrgpvqlswnfnykaagdalgidllnnp
dlvqndsavawktglwywntqtgpgtmtphdamvngagfgetirsingslecdggnpgqv
qsridnyerftqllgvepggnlsc

SCOPe Domain Coordinates for d2cjla_:

Click to download the PDB-style file with coordinates for d2cjla_.
(The format of our PDB-style files is described here.)

Timeline for d2cjla_: