Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (18 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [187551] (1 PDB entry) |
Domain d2cjla_: 2cjl A: [163420] automated match to d1cnsa_ complexed with zn |
PDB Entry: 2cjl (more details), 1.5 Å
SCOPe Domain Sequences for d2cjla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cjla_ d.2.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]} fvvseaqfdqmfpsrnsfytysgltaalsaypgfsntgsdtvkkqeaaaflanvghetgg lvyvveqntanyphycdasqpygcpagndkyygrgpvqlswnfnykaagdalgidllnnp dlvqndsavawktglwywntqtgpgtmtphdamvngagfgetirsingslecdggnpgqv qsridnyerftqllgvepggnlsc
Timeline for d2cjla_: