Lineage for d2cipa_ (2cip A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082782Protein automated matches [190057] (26 species)
    not a true protein
  7. 2082836Species Clostridium thermocellum [TaxId:1515] [187247] (4 PDB entries)
  8. 2082838Domain d2cipa_: 2cip A: [163418]
    automated match to d2bv9a1
    complexed with zz1

Details for d2cipa_

PDB Entry: 2cip (more details), 1.4 Å

PDB Description: structure of the michaelis complex of a family 26 lichenase
PDB Compounds: (A:) endoglucanase h

SCOPe Domain Sequences for d2cipa_:

Sequence, based on SEQRES records: (download)

>d2cipa_ c.1.8.3 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
sglkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilm
itwepweyntvdikngkadayitrmaqdmkaygkeiwlrplheangdwypwaigyssrvn
tnetyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgyn
wgttqswgsqwqsfdqvfsrayqalasinkpiiiaqfasaeiggnkarwiteaynsirts
ynkviaavwfhenketdwrinsspealaayreaiga

Sequence, based on observed residues (ATOM records): (download)

>d2cipa_ c.1.8.3 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
sglkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilm
itwepweyntvdikngkadayitrmaqdmkaygkeiwlrplheangdwypwaigyssrvn
tnetyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgyn
wgttqsqwqsfdqvfsrayqalasinkpiiiaqfasaeiggnkarwiteaynsirtsynk
viaavwfhenketdwrinsspealaayreaiga

SCOPe Domain Coordinates for d2cipa_:

Click to download the PDB-style file with coordinates for d2cipa_.
(The format of our PDB-style files is described here.)

Timeline for d2cipa_: