SCOPe 2.01: Domain d2ci8a_: 2ci8 A:

Lineage for d2ci8a_ (2ci8 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (1 PDB entry)

8. Domain d2ci8a_: 2ci8 A: [163413]
   automated match to d1bm2a_
   complexed with 1pe, so4

Details for d2ci8a_

PDB Entry: 2ci8, 1.8 Å

PDB Description: sh2 domain of human nck1 adaptor protein - uncomplexed

PDB Compounds: (A:) cytoplasmic protein nck1

SCOPe Domain Sequences for d2ci8a_:

Sequence; same for both SEQRES and ATOM records:

>d2ci8a_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spwyygkvtrhqaemalnerghegdflirdsesspndfsvslkaqgknkhfkvqlketvy
cigqrkfstmeelvehykkapiftseqgeklylvkhlss

Timeline for d2ci8a_:

• d2ci8a_ is new in SCOPe 2.01-stable
  
• d2ci8a_ appears in SCOPe 2.02
  
• d2ci8a_ appears in the current release, SCOPe 2.08, called d2ci8a1