SCOP 1.67: Domain d1hnwt_: 1hnw T:

Lineage for d1hnwt_ (1hnw T:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.7: Spectrin repeat-like [46965] (9 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family)

5. Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
   this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain

6. Protein Ribosomal protein S20 [46994] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries)

8. Domain d1hnwt_: 1hnw T: [16341]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwt_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwt_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

Timeline for d1hnwt_:

• d1hnwt_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwt_ appears in SCOP 1.65
  
• d1hnwt_ appears in SCOP 1.69
  
• d1hnwt_ appears in the current release, SCOPe 2.08