Lineage for d2chpd_ (2chp D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2703994Species Bacillus subtilis [TaxId:1423] [187547] (2 PDB entries)
  8. 2704000Domain d2chpd_: 2chp D: [163405]
    automated match to d1ji5a_
    complexed with po4

Details for d2chpd_

PDB Entry: 2chp (more details), 2 Å

PDB Description: crystal structure of the dodecameric ferritin mrga from b. subtilis 168
PDB Compounds: (D:) metalloregulation DNA-binding stress protein

SCOPe Domain Sequences for d2chpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chpd_ a.25.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
nqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiaerl
laiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenqdn
atadlfvglieevekqvwmlssylg

SCOPe Domain Coordinates for d2chpd_:

Click to download the PDB-style file with coordinates for d2chpd_.
(The format of our PDB-style files is described here.)

Timeline for d2chpd_: