| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [187547] (2 PDB entries) |
| Domain d2chpd_: 2chp D: [163405] automated match to d1ji5a_ complexed with po4 |
PDB Entry: 2chp (more details), 2 Å
SCOPe Domain Sequences for d2chpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chpd_ a.25.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
nqtlvenslntqlsnwfllysklhrfhwyvkgphfftlhekfeelydhaaetvdtiaerl
laiggqpvatvkeytehasitdggnetsasemvqalvndykqisseskfviglaeenqdn
atadlfvglieevekqvwmlssylg
Timeline for d2chpd_: