| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 protein domains) |
| Protein automated matches [190041] (18 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187027] (11 PDB entries) |
| Domain d2chia_: 2chi A: [163404] automated match to d1fhaa_ complexed with ca, gol, zn; mutant |
| PDB Entry: 2chi (more details) PDB Description: recombinant human h ferritin, k86q and e27d mutant
PDB Compounds: (A:) ferritin heavy chainSCOP Domain Sequences for d2chia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chia_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinldlyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
SCOP Domain Coordinates for d2chia_:
Click to download the PDB-style file with coordinates for d2chia_. (The format of our PDB-style files is described here.)
Timeline for d2chia_:
d2chia_ appears in SCOP 1.75A | d2chia_ (click for larger image) d2chia_ in context of chain |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |