SCOPe 2.01: Domain d2ch9a_: 2ch9 A:

Lineage for d2ch9a_ (2ch9 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187545] (1 PDB entry)

8. Domain d2ch9a_: 2ch9 A: [163403]
   automated match to d1a90a_
   complexed with act, nag, zn

Details for d2ch9a_

PDB Entry: 2ch9, 2.1 Å

PDB Description: crystal structure of dimeric human cystatin f

PDB Compounds: (A:) cystatin f

SCOPe Domain Sequences for d2ch9a_:

Sequence; same for both SEQRES and ATOM records:

>d2ch9a_ d.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcsqdlnsrvkpgfpktiktndpgvlqaarysvekfnnctndmflfkesritralvqivk
glkymleveigrttckknqhlrlddcdfqtnhtlkqtlscysevwvvpwlqhfevpvlrc
hhhhhh

Timeline for d2ch9a_:

• d2ch9a_ is new in SCOPe 2.01-stable
  
• d2ch9a_ appears in SCOPe 2.02
  
• d2ch9a_ appears in the current release, SCOPe 2.08, called d2ch9a1