Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187545] (1 PDB entry) |
Domain d2ch9a_: 2ch9 A: [163403] automated match to d1a90a_ complexed with act, nag, zn |
PDB Entry: 2ch9 (more details), 2.1 Å
SCOPe Domain Sequences for d2ch9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch9a_ d.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tcsqdlnsrvkpgfpktiktndpgvlqaarysvekfnnctndmflfkesritralvqivk glkymleveigrttckknqhlrlddcdfqtnhtlkqtlscysevwvvpwlqhfevpvlrc hhhhhh
Timeline for d2ch9a_: