![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (9 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) |
![]() | Protein Ribosomal protein S20 [46994] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (14 PDB entries) |
![]() | Domain d1hnzt_: 1hnz T: [16340] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus} rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1hnzt_: