Lineage for d1hnzt_ (1hnz T:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45997Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 46062Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 46063Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 46064Protein Ribosomal protein S20 [46994] (1 species)
  7. 46065Species Thermus thermophilus [TaxId:274] [46995] (10 PDB entries)
  8. 46069Domain d1hnzt_: 1hnz T: [16340]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzv_

Details for d1hnzt_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1hnzt_:

Click to download the PDB-style file with coordinates for d1hnzt_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzt_: