SCOPe 2.06: Domain d2cffa_: 2cff A:

Lineage for d2cffa_ (2cff A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA [51368] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [51369] (2 PDB entries)

8. Domain d2cffa_: 2cff A: [163397]
   automated match to d1qo2a_
   complexed with mpd; mutant

Details for d2cffa_

PDB Entry: 2cff, 2.5 Å

PDB Description: crystal structure of n-((5'-phosphoribosyl)-formimino)-5- aminoimidazol-4-carboxamid ribonucleotid isomerase mutant d127v (ec 3. 1.3.15, hisa)

PDB Compounds: (A:) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d2cffa_:

Sequence; same for both SEQRES and ATOM records:

>d2cffa_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]}
mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg
enlpvleklsefaehiqigggirsldyaeklrklgyrrqivsskvledpsflkslreidv
epvfslvtrggrvafkgwlaeeeidpvsllkrlkeygleeivhteiekdgtlqehdfslt
kkiaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkrya
r

Timeline for d2cffa_:

• d2cffa_ first appeared in SCOPe 2.01
  
• d2cffa_ appears in SCOPe 2.05
  
• d2cffa_ appears in SCOPe 2.07
  
• d2cffa_ appears in the current release, SCOPe 2.08