Lineage for d2cfcd_ (2cfc D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978522Species Xanthobacter autotrophicus [TaxId:78245] [187540] (1 PDB entry)
  8. 978526Domain d2cfcd_: 2cfc D: [163396]
    automated match to d1iy8a_
    complexed with kpc, nad

Details for d2cfcd_

PDB Entry: 2cfc (more details), 1.8 Å

PDB Description: structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases
PDB Compounds: (D:) 2-(r)-hydroxypropyl-com dehydrogenase

SCOPe Domain Sequences for d2cfcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfcd_ c.2.1.0 (D:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
msrvaivtgassgnglaiatrflargdrvaaldlsaetleetarthwhayadkvlrvrad
vadegdvnaaiaatmeqfgaidvlvnnagitgnseagvlhttpveqfdkvmavnvrgifl
gcravlphmllqgagvivniasvaslvafpgrsayttskgavlqltksvavdyagsgirc
navcpgmietpmtqwrldqpelrdqvlaripqkeigtaaqvadavmflagedatyvngaa
lvmdgaytai

SCOPe Domain Coordinates for d2cfcd_:

Click to download the PDB-style file with coordinates for d2cfcd_.
(The format of our PDB-style files is described here.)

Timeline for d2cfcd_: