Lineage for d2cfcb_ (2cfc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849289Species Xanthobacter autotrophicus [TaxId:78245] [187540] (3 PDB entries)
  8. 2849299Domain d2cfcb_: 2cfc B: [163394]
    automated match to d1iy8a_
    complexed with kpc, nad

Details for d2cfcb_

PDB Entry: 2cfc (more details), 1.8 Å

PDB Description: structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases
PDB Compounds: (B:) 2-(r)-hydroxypropyl-com dehydrogenase

SCOPe Domain Sequences for d2cfcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfcb_ c.2.1.0 (B:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
msrvaivtgassgnglaiatrflargdrvaaldlsaetleetarthwhayadkvlrvrad
vadegdvnaaiaatmeqfgaidvlvnnagitgnseagvlhttpveqfdkvmavnvrgifl
gcravlphmllqgagvivniasvaslvafpgrsayttskgavlqltksvavdyagsgirc
navcpgmietpmtqwrldqpelrdqvlaripqkeigtaaqvadavmflagedatyvngaa
lvmdgaytai

SCOPe Domain Coordinates for d2cfcb_:

Click to download the PDB-style file with coordinates for d2cfcb_.
(The format of our PDB-style files is described here.)

Timeline for d2cfcb_: