Lineage for d2cf7h_ (2cf7 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316503Species Streptococcus suis [TaxId:1307] [187539] (1 PDB entry)
  8. 2316511Domain d2cf7h_: 2cf7 H: [163388]
    automated match to d1umng_
    complexed with ca, cl, epe; mutant

Details for d2cf7h_

PDB Entry: 2cf7 (more details), 1.5 Å

PDB Description: asp74ala mutant crystal structure for dps-like peroxide resistance protein dpr from streptococcus suis.
PDB Compounds: (H:) dpr

SCOPe Domain Sequences for d2cf7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cf7h_ a.25.1.1 (H:) automated matches {Streptococcus suis [TaxId: 1307]}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2cf7h_:

Click to download the PDB-style file with coordinates for d2cf7h_.
(The format of our PDB-style files is described here.)

Timeline for d2cf7h_: