SCOPe 2.01: Domain d2ce1a_: 2ce1 A:

Lineage for d2ce1a_ (2ce1 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (7 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries)

8. Domain d2ce1a_: 2ce1 A: [163377]
   automated match to d1c6sa_
   complexed with hec

Details for d2ce1a_

PDB Entry: 2ce1, 1.4 Å

PDB Description: structure of reduced arabidopsis thaliana cytochrome 6a

PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d2ce1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ce1a_ a.3.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ldiqrgatlfnracaachdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrmpg
fgekctprgqctfgprlqdeeikllaefvkfqadqgwptv

Timeline for d2ce1a_:

• d2ce1a_ is new in SCOPe 2.01-stable
  
• d2ce1a_ appears in SCOPe 2.02
  
• d2ce1a_ appears in the current release, SCOPe 2.08