Lineage for d2cd7a_ (2cd7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874896Protein automated matches [190554] (2 species)
    not a true protein
  7. 2874899Species Staphylococcus aureus [TaxId:1280] [187537] (1 PDB entry)
  8. 2874900Domain d2cd7a_: 2cd7 A: [163374]
    automated match to d1ljua_
    complexed with na; mutant

Details for d2cd7a_

PDB Entry: 2cd7 (more details), 1.5 Å

PDB Description: staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant
PDB Compounds: (A:) protein arsc

SCOPe Domain Sequences for d2cd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cd7a_ c.44.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mdkktiyfictgnscrsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidis
nqtsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrde
iklaiekfklr

SCOPe Domain Coordinates for d2cd7a_:

Click to download the PDB-style file with coordinates for d2cd7a_.
(The format of our PDB-style files is described here.)

Timeline for d2cd7a_: