Lineage for d2ccjb_ (2ccj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850308Species Staphylococcus aureus [TaxId:1280] [187532] (4 PDB entries)
  8. 1850310Domain d2ccjb_: 2ccj B: [163369]
    automated match to d4tmka_
    complexed with cl, edo, tmp

Details for d2ccjb_

PDB Entry: 2ccj (more details), 1.7 Å

PDB Description: crystal structure of s. aureus thymidylate kinase complexed with thymidine monophosphate
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d2ccjb_:

Sequence, based on SEQRES records: (download)

>d2ccjb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records): (download)

>d2ccjb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknnrldqedlkfhekviegyqeiiqrfksvnadqplen
vvedtyqtiikyleki

SCOPe Domain Coordinates for d2ccjb_:

Click to download the PDB-style file with coordinates for d2ccjb_.
(The format of our PDB-style files is described here.)

Timeline for d2ccjb_: