SCOPe 2.07: Domain d2cbtb_: 2cbt B:

Lineage for d2cbtb_ (2cbt B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein automated matches [190548] (1 species)
   not a true protein

7. Species Streptomyces carzinostaticus [TaxId:1897] [187528] (4 PDB entries)

8. Domain d2cbtb_: 2cbt B: [163367]
   automated match to d1j5ha_
   complexed with th2; mutant

Details for d2cbtb_

PDB Entry: 2cbt, 2.2 Å

PDB Description: crystal structure of the neocarzinostatin 4tes1 mutant bound testosterone hemisuccinate.

PDB Compounds: (B:) neocarzinostatin

SCOPe Domain Sequences for d2cbtb_:

Sequence; same for both SEQRES and ATOM records:

>d2cbtb_ b.1.7.1 (B:) automated matches {Streptomyces carzinostaticus [TaxId: 1897]}
aptatvtpssglsdgtvvkvagaglqagtaywvaqsawvdtgvyasnpadissvtadang
sastsltvrrsfegflwdgtrwgtvdcttaachvtlrdalsngpegvaisf

Timeline for d2cbtb_:

• d2cbtb_ first appeared in SCOPe 2.01
  
• d2cbtb_ appears in SCOPe 2.06
  
• d2cbtb_ appears in the current release, SCOPe 2.08