| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) ![]() automatically mapped to Pfam PF00960 |
| Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins) |
| Protein automated matches [190548] (1 species) not a true protein |
| Species Streptomyces carzinostaticus [TaxId:1897] [187528] (4 PDB entries) |
| Domain d2cbtb_: 2cbt B: [163367] automated match to d1j5ha_ complexed with th2; mutant |
PDB Entry: 2cbt (more details), 2.2 Å
SCOPe Domain Sequences for d2cbtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbtb_ b.1.7.1 (B:) automated matches {Streptomyces carzinostaticus [TaxId: 1897]}
aptatvtpssglsdgtvvkvagaglqagtaywvaqsawvdtgvyasnpadissvtadang
sastsltvrrsfegflwdgtrwgtvdcttaachvtlrdalsngpegvaisf
Timeline for d2cbtb_: