Lineage for d2cbtb_ (2cbt B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763669Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) (S)
    automatically mapped to Pfam PF00960
  5. 2763670Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)
  6. 2763696Protein automated matches [190548] (1 species)
    not a true protein
  7. 2763697Species Streptomyces carzinostaticus [TaxId:1897] [187528] (4 PDB entries)
  8. 2763707Domain d2cbtb_: 2cbt B: [163367]
    automated match to d1j5ha_
    complexed with th2; mutant

Details for d2cbtb_

PDB Entry: 2cbt (more details), 2.2 Å

PDB Description: crystal structure of the neocarzinostatin 4tes1 mutant bound testosterone hemisuccinate.
PDB Compounds: (B:) neocarzinostatin

SCOPe Domain Sequences for d2cbtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbtb_ b.1.7.1 (B:) automated matches {Streptomyces carzinostaticus [TaxId: 1897]}
aptatvtpssglsdgtvvkvagaglqagtaywvaqsawvdtgvyasnpadissvtadang
sastsltvrrsfegflwdgtrwgtvdcttaachvtlrdalsngpegvaisf

SCOPe Domain Coordinates for d2cbtb_:

Click to download the PDB-style file with coordinates for d2cbtb_.
(The format of our PDB-style files is described here.)

Timeline for d2cbtb_: