SCOPe 2.05: Domain d2cbqf_: 2cbq F:

Lineage for d2cbqf_ (2cbq F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein automated matches [190548] (1 species)
   not a true protein

7. Species Streptomyces carzinostaticus [TaxId:1897] [187528] (4 PDB entries)

8. Domain d2cbqf_: 2cbq F: [163365]
   automated match to d1j5ha_
   complexed with so4, th2; mutant

Details for d2cbqf_

PDB Entry: 2cbq, 2.6 Å

PDB Description: crystal structure of the neocarzinostatin 1tes15 mutant bound to testosterone hemisuccinate.

PDB Compounds: (F:) neocarzinostatin

SCOPe Domain Sequences for d2cbqf_:

Sequence; same for both SEQRES and ATOM records:

>d2cbqf_ b.1.7.1 (F:) automated matches {Streptomyces carzinostaticus [TaxId: 1897]}
aptatvtpssglsdgtvvkvagaglqagtaywvyqraavdtgvhasnpadlssvtadang
sastsltvrrsfegflfdgtrwgtvdcttaacqvglsdaagngpegvaisf

Timeline for d2cbqf_:

• d2cbqf_ first appeared in SCOPe 2.01
  
• d2cbqf_ appears in SCOPe 2.04
  
• d2cbqf_ appears in SCOPe 2.06
  
• d2cbqf_ appears in the current release, SCOPe 2.08