SCOPe 2.05: Domain d1qsdb_: 1qsd B:

Lineage for d1qsdb_ (1qsd B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.5: Tubulin chaperone cofactor A [46988] (1 family)
   automatically mapped to Pfam PF02970

5. Family a.7.5.1: Tubulin chaperone cofactor A [46989] (1 protein)
   the C-terminal helix is shorter that the other two helices
   this is a repeat family; one repeat unit is 1qsd A: found in domain

6. Protein Tubulin chaperone cofactor A [46990] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), Rbl2p [TaxId:4932] [46991] (1 PDB entry)

8. Domain d1qsdb_: 1qsd B: [16336]

Details for d1qsdb_

PDB Entry: 1qsd, 2.2 Å

PDB Description: rbl2p, beta-tubulin binding post-chaperonin cofactor

PDB Compounds: (B:) protein (beta-tubulin binding post-chaperonin cofactor)

SCOPe Domain Sequences for d1qsdb_:

Sequence; same for both SEQRES and ATOM records:

>d1qsdb_ a.7.5.1 (B:) Tubulin chaperone cofactor A {Baker's yeast (Saccharomyces cerevisiae), Rbl2p [TaxId: 4932]}
tqldikvkalkrltkeegyyqqelkdqeahvaklkedksvdpydlkkqeevlddtkrllp
tlyekirefkedleqflktyqgtedvsdarsaitsaqellds

Timeline for d1qsdb_:

• d1qsdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qsdb_ appears in SCOPe 2.04
  
• d1qsdb_ appears in SCOPe 2.06
  
• d1qsdb_ appears in the current release, SCOPe 2.08