![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.5: Tubulin chaperone cofactor A [46988] (1 family) ![]() automatically mapped to Pfam PF02970 |
![]() | Family a.7.5.1: Tubulin chaperone cofactor A [46989] (1 protein) the C-terminal helix is shorter that the other two helices this is a repeat family; one repeat unit is 1qsd A: found in domain |
![]() | Protein Tubulin chaperone cofactor A [46990] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), Rbl2p [TaxId:4932] [46991] (1 PDB entry) |
![]() | Domain d1qsdb_: 1qsd B: [16336] |
PDB Entry: 1qsd (more details), 2.2 Å
SCOPe Domain Sequences for d1qsdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsdb_ a.7.5.1 (B:) Tubulin chaperone cofactor A {Baker's yeast (Saccharomyces cerevisiae), Rbl2p [TaxId: 4932]} tqldikvkalkrltkeegyyqqelkdqeahvaklkedksvdpydlkkqeevlddtkrllp tlyekirefkedleqflktyqgtedvsdarsaitsaqellds
Timeline for d1qsdb_: