Lineage for d2cb8b_ (2cb8 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309710Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309711Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2309712Family a.11.1.1: Acyl-CoA binding protein [47028] (2 protein domains)
    automatically mapped to Pfam PF00887
  6. 2309725Protein automated matches [190551] (1 species)
    not a true protein
  7. 2309726Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)
  8. 2309728Domain d2cb8b_: 2cb8 B: [163357]
    automated match to d1acaa_
    complexed with mxe, mya, so4, zn

Details for d2cb8b_

PDB Entry: 2cb8 (more details), 1.4 Å

PDB Description: high resolution crystal structure of liganded human l-acbp
PDB Compounds: (B:) acyl-coa-binding protein

SCOPe Domain Sequences for d2cb8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cb8b_ a.11.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaefekaaeevrhlktkpsdeemlfiyghykqatvgdinterpgmldftgkakwdawnel
kgtskedamkayinkveelkkkygi

SCOPe Domain Coordinates for d2cb8b_:

Click to download the PDB-style file with coordinates for d2cb8b_.
(The format of our PDB-style files is described here.)

Timeline for d2cb8b_: