Lineage for d2c9jg_ (2c9j G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547768Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry)
  8. 2547775Domain d2c9jg_: 2c9j G: [163350]
    automated match to d1uisa_

Details for d2c9jg_

PDB Entry: 2c9j (more details), 1.35 Å

PDB Description: structure of the fluorescent protein cmfp512 at 1.35a from cerianthus membranaceus
PDB Compounds: (G:) green fluorescent protein fp512

SCOPe Domain Sequences for d2c9jg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9jg_ d.22.1.0 (G:) automated matches {Cerianthus membranaceus [TaxId: 208460]}
dnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqyg
fraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvn
fppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgq
plpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp

SCOPe Domain Coordinates for d2c9jg_:

Click to download the PDB-style file with coordinates for d2c9jg_.
(The format of our PDB-style files is described here.)

Timeline for d2c9jg_: