![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (17 species) not a true protein |
![]() | Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry) |
![]() | Domain d2c9jg_: 2c9j G: [163350] automated match to d1uisa_ |
PDB Entry: 2c9j (more details), 1.35 Å
SCOPe Domain Sequences for d2c9jg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9jg_ d.22.1.0 (G:) automated matches {Cerianthus membranaceus [TaxId: 208460]} dnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqyg fraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvn fppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgq plpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp
Timeline for d2c9jg_: