Lineage for d2c9je_ (2c9j E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1407998Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry)
  8. 1408003Domain d2c9je_: 2c9j E: [163348]
    automated match to d1uisa_

Details for d2c9je_

PDB Entry: 2c9j (more details), 1.35 Å

PDB Description: structure of the fluorescent protein cmfp512 at 1.35a from cerianthus membranaceus
PDB Compounds: (E:) green fluorescent protein fp512

SCOPe Domain Sequences for d2c9je_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9je_ d.22.1.0 (E:) automated matches {Cerianthus membranaceus [TaxId: 208460]}
dnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqyg
fraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvn
fppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgq
plpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpkp

SCOPe Domain Coordinates for d2c9je_:

Click to download the PDB-style file with coordinates for d2c9je_.
(The format of our PDB-style files is described here.)

Timeline for d2c9je_: