| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (25 species) not a true protein |
| Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry) |
| Domain d2c9jb_: 2c9j B: [163345] automated match to d1uisa_ |
PDB Entry: 2c9j (more details), 1.35 Å
SCOPe Domain Sequences for d2c9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9jb_ d.22.1.0 (B:) automated matches {Cerianthus membranaceus [TaxId: 208460]}
ldnnlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqy
gfraftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgv
nfppngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksg
qplpgfhfikhrlvktkvepgfkmveqaeyatahvcdlpk
Timeline for d2c9jb_: