SCOPe 2.06: Domain d2c9ja_: 2c9j A:

Lineage for d2c9ja_ (2c9j A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry)

8. Domain d2c9ja_: 2c9j A: [163344]
   automated match to d1uisa_

Details for d2c9ja_

PDB Entry: 2c9j, 1.35 Å

PDB Description: structure of the fluorescent protein cmfp512 at 1.35a from cerianthus membranaceus

PDB Compounds: (A:) green fluorescent protein fp512

SCOPe Domain Sequences for d2c9ja_:

Sequence; same for both SEQRES and ATOM records:

>d2c9ja_ d.22.1.0 (A:) automated matches {Cerianthus membranaceus [TaxId: 208460]}
nlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqygfr
aftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvnfp
pngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgqpl
pgfhfikhrlvktkvepgfkmveqaeyatahvcdlp

Timeline for d2c9ja_:

• d2c9ja_ first appeared in SCOPe 2.01
  
• d2c9ja_ appears in SCOPe 2.05
  
• d2c9ja_ appears in SCOPe 2.07
  
• d2c9ja_ appears in the current release, SCOPe 2.08