SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2c9ja_ (2c9j A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165374Species Cerianthus membranaceus [TaxId:208460] [188528] (1 PDB entry)
  8. 2165375Domain d2c9ja_: 2c9j A: [163344]
    automated match to d1uisa_

Details for d2c9ja_

PDB Entry: 2c9j (more details), 1.35 Å

PDB Description: structure of the fluorescent protein cmfp512 at 1.35a from cerianthus membranaceus
PDB Compounds: (A:) green fluorescent protein fp512

SCOPe Domain Sequences for d2c9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9ja_ d.22.1.0 (A:) automated matches {Cerianthus membranaceus [TaxId: 208460]}
nlsvsvymkgnvnnhefeydgigggdpnsgqfslktklrggkplpfsydiitmgfqygfr
aftkypegiadyfkgsfpeafqwnrriefedggvinmssditykdkvlhgdvwalgvnfp
pngpvmkneivmeepaeetltakngvlvgfcpkayllkdgsyyyghmttfyrskksgqpl
pgfhfikhrlvktkvepgfkmveqaeyatahvcdlp

SCOPe Domain Coordinates for d2c9ja_:

Click to download the PDB-style file with coordinates for d2c9ja_.
(The format of our PDB-style files is described here.)

Timeline for d2c9ja_: