Lineage for d2c9ih_ (2c9i H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2185077Species Sea anemone (Anemonia sulcata) [TaxId:6108] [188527] (2 PDB entries)
  8. 2185087Domain d2c9ih_: 2c9i H: [163343]
    automated match to d1uisa_

Details for d2c9ih_

PDB Entry: 2c9i (more details), 1.82 Å

PDB Description: structure of the fluorescent protein asfp499 from anemonia sulcata
PDB Compounds: (H:) green fluorescent protein asfp499

SCOPe Domain Sequences for d2c9ih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9ih_ d.22.1.1 (H:) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
ypsiketmrvqlsmegsvnyhafkctgkgegkpyegtqslnititeggplpfafdilsha
fqygikvfakypkeipdffkqslpggfswervstyedggvlsatqetslqgdciickvkv
lgtnfpangpvmqkktcgwepstetviprdgglllrdtpalmladgghlscfmettyksk
kevklpelhfhhlrmeklnisddwktveqhesvvasysqvpsklghn

SCOPe Domain Coordinates for d2c9ih_:

Click to download the PDB-style file with coordinates for d2c9ih_.
(The format of our PDB-style files is described here.)

Timeline for d2c9ih_: