SCOPe 2.02: Domain d2c9if_: 2c9i F:

Lineage for d2c9if_ (2c9i F:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Sea anemone (Anemonia sulcata) [TaxId:6108] [188527] (2 PDB entries)

8. Domain d2c9if_: 2c9i F: [163341]
   automated match to d1uisa_

Details for d2c9if_

PDB Entry: 2c9i, 1.82 Å

PDB Description: structure of the fluorescent protein asfp499 from anemonia sulcata

PDB Compounds: (F:) green fluorescent protein asfp499

SCOPe Domain Sequences for d2c9if_:

Sequence; same for both SEQRES and ATOM records:

>d2c9if_ d.22.1.1 (F:) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
ypsiketmrvqlsmegsvnyhafkctgkgegkpyegtqslnititeggplpfafdilsha
fqygikvfakypkeipdffkqslpggfswervstyedggvlsatqetslqgdciickvkv
lgtnfpangpvmqkktcgwepstetviprdgglllrdtpalmladgghlscfmettyksk
kevklpelhfhhlrmeklnisddwktveqhesvvasysqvpsklghn

Timeline for d2c9if_:

• d2c9if_ first appeared in SCOPe 2.01
  
• d2c9if_ appears in SCOPe 2.03
  
• d2c9if_ appears in the current release, SCOPe 2.08