Lineage for d2c9id_ (2c9i D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940523Species Sea anemone (Anemonia sulcata) [TaxId:6108] [188527] (2 PDB entries)
  8. 2940529Domain d2c9id_: 2c9i D: [163339]
    automated match to d1uisa_

Details for d2c9id_

PDB Entry: 2c9i (more details), 1.82 Å

PDB Description: structure of the fluorescent protein asfp499 from anemonia sulcata
PDB Compounds: (D:) green fluorescent protein asfp499

SCOPe Domain Sequences for d2c9id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9id_ d.22.1.1 (D:) automated matches {Sea anemone (Anemonia sulcata) [TaxId: 6108]}
mypsiketmrvqlsmegsvnyhafkctgkgegkpyegtqslnititeggplpfafdilsh
afqygikvfakypkeipdffkqslpggfswervstyedggvlsatqetslqgdciickvk
vlgtnfpangpvmqkktcgwepstetviprdgglllrdtpalmladgghlscfmettyks
kkevklpelhfhhlrmeklnisddwktveqhesvvasysqvpsklghn

SCOPe Domain Coordinates for d2c9id_:

Click to download the PDB-style file with coordinates for d2c9id_.
(The format of our PDB-style files is described here.)

Timeline for d2c9id_: