SCOPe 2.01: Domain d2c95b_: 2c95 B:

Lineage for d2c95b_ (2c95 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187523] (6 PDB entries)

8. Domain d2c95b_: 2c95 B: [163335]
   automated match to d3adka_
   complexed with b4p, mli

Details for d2c95b_

PDB Entry: 2c95, 1.71 Å

PDB Description: structure of adenylate kinase 1 in complex with p1,p4-di(adenosine) tetraphosphate

PDB Compounds: (B:) adenylate kinase 1

SCOPe Domain Sequences for d2c95b_:

Sequence; same for both SEQRES and ATOM records:

>d2c95b_ c.37.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeklkktniifvvggpgsgkgtqcekivqkygythlstgdllrsevssgsargkklseim
ekgqlvpletvldmlrdamvakvntskgflidgyprevqqgeeferrigqptlllyvdag
petmtqrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvds
vfsqvcthldalln

Timeline for d2c95b_:

• d2c95b_ is new in SCOPe 2.01-stable
  
• d2c95b_ appears in SCOPe 2.02
  
• d2c95b_ appears in the current release, SCOPe 2.08, called d2c95b1