Lineage for d2c95b1 (2c95 B:2-194)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866286Species Human (Homo sapiens) [TaxId:9606] [187523] (8 PDB entries)
  8. 2866293Domain d2c95b1: 2c95 B:2-194 [163335]
    Other proteins in same PDB: d2c95a2, d2c95b2
    automated match to d3adka_
    complexed with b4p, mli

Details for d2c95b1

PDB Entry: 2c95 (more details), 1.71 Å

PDB Description: structure of adenylate kinase 1 in complex with p1,p4-di(adenosine) tetraphosphate
PDB Compounds: (B:) adenylate kinase 1

SCOPe Domain Sequences for d2c95b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c95b1 c.37.1.1 (B:2-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeklkktniifvvggpgsgkgtqcekivqkygythlstgdllrsevssgsargkklseim
ekgqlvpletvldmlrdamvakvntskgflidgyprevqqgeeferrigqptlllyvdag
petmtqrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvds
vfsqvcthldall

SCOPe Domain Coordinates for d2c95b1:

Click to download the PDB-style file with coordinates for d2c95b1.
(The format of our PDB-style files is described here.)

Timeline for d2c95b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c95b2