Lineage for d2c91h_ (2c91 H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829537Protein automated matches [190169] (7 species)
    not a true protein
  7. 2829619Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries)
  8. 2829645Domain d2c91h_: 2c91 H: [163331]
    automated match to d1gvea_
    complexed with gol, mes, nap, po4, tla

Details for d2c91h_

PDB Entry: 2c91 (more details), 2.3 Å

PDB Description: mouse succinic semialdehyde reductase, akr7a5
PDB Compounds: (H:) aflatoxin b1 aldehyde reductase member 2

SCOPe Domain Sequences for d2c91h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c91h_ c.1.7.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lrpatvlgtmemgrrmdasasaasvraflerghseldtafmycdgqsenilgglglglgs
gdctvkiatkanpwegkslkpdsirsqletslkrlqcprvdlfylhapdhstpveetlca
chqlhqegkfvelglsnyaswevaeictlcksngwilptvyqgmynattrqveaellpcl
rhfglrfyaynplagglltgkykyedkdgkqpvgrffgnnwaetyrnrfwkehhfeaial
vekalqttygtnaprmtsaalrwmyhhsqlqgtrgdavilgmssleqleqnlaateegpl
epavveafdqawnmvahecpnyfr

SCOPe Domain Coordinates for d2c91h_:

Click to download the PDB-style file with coordinates for d2c91h_.
(The format of our PDB-style files is described here.)

Timeline for d2c91h_: