![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.4: Smac/diablo [46984] (1 family) ![]() |
![]() | Family a.7.4.1: Smac/diablo [46985] (1 protein) this is a repeat family; one repeat unit is 1few A: found in domain |
![]() | Protein Smac/diablo [46986] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46987] (2 PDB entries) |
![]() | Domain d1g73b_: 1g73 B: [16333] Other proteins in same PDB: d1g73c_, d1g73d_ bound to xiap-bir3 domain complexed with zn; mutant |
PDB Entry: 1g73 (more details), 2 Å
SCOP Domain Sequences for d1g73b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g73b_ a.7.4.1 (B:) Smac/diablo {Human (Homo sapiens) [TaxId: 9606]} avpiaqksephslssealmrravslvtdststdlsqttyalieaiteytkavytltslyr qytsllgkmnseeedevwqviigaraemtskhqeylklettwmtavglsemaaeaayqtg adqasitarnhiqlvklqveevhqlsrkaetklaeaq
Timeline for d1g73b_: