SCOP 1.75: Domain d1g73b_: 1g73 B:

Lineage for d1g73b_ (1g73 B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.4: Smac/diablo [46984] (1 family)

5. Family a.7.4.1: Smac/diablo [46985] (1 protein)
   this is a repeat family; one repeat unit is 1few A: found in domain

6. Protein Smac/diablo [46986] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46987] (2 PDB entries)

8. Domain d1g73b_: 1g73 B: [16333]
   Other proteins in same PDB: d1g73c_, d1g73d_
   bound to xiap-bir3 domain
   complexed with zn; mutant

Details for d1g73b_

PDB Entry: 1g73, 2 Å

PDB Description: crystal structure of smac bound to xiap-bir3 domain

PDB Compounds: (B:) second mitochondria-derived activator of caspases

SCOP Domain Sequences for d1g73b_:

Sequence; same for both SEQRES and ATOM records:

>d1g73b_ a.7.4.1 (B:) Smac/diablo {Human (Homo sapiens) [TaxId: 9606]}
avpiaqksephslssealmrravslvtdststdlsqttyalieaiteytkavytltslyr
qytsllgkmnseeedevwqviigaraemtskhqeylklettwmtavglsemaaeaayqtg
adqasitarnhiqlvklqveevhqlsrkaetklaeaq

Timeline for d1g73b_:

• d1g73b_ first appeared (with stable ids) in SCOP 1.55
  
• d1g73b_ appears in SCOP 1.73
  
• d1g73b_ appears in SCOPe 2.01
  
• d1g73b_ appears in the current release, SCOPe 2.08