Lineage for d2c8jb_ (2c8j B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160865Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2160866Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2160936Protein automated matches [190319] (2 species)
    not a true protein
  7. 2160937Species Bacillus anthracis [TaxId:198094] [187522] (1 PDB entry)
  8. 2160939Domain d2c8jb_: 2c8j B: [163323]
    automated match to d1ak1a_

Details for d2c8jb_

PDB Entry: 2c8j (more details), 2.1 Å

PDB Description: crystal structure of ferrochelatase hemh-1 from bacillus anthracis, str. ames
PDB Compounds: (B:) ferrochelatase 1

SCOPe Domain Sequences for d2c8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8jb_ c.92.1.1 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
kkkigllvmaygtpykeedieryythirrgrkpspemledlteryraiggisplatitle
qakklekrlnevqdeveyhmylglkhiepfiedavkemhndgiqdaialvlaphystfsv
ksyvgraqeeaeklgnltihgidswykepkfiqywvdavksiysgmsdaerekavlivsa
hslpekiiamgdpypdqlnetadyiargaevanyavgwqsagntpdpwigpdvqdltrel
nekygytsfvyapvgfvaehlevlydndfeckvvtdeigakyyrpempnasdafidcltd
vvvkkkesvm

SCOPe Domain Coordinates for d2c8jb_:

Click to download the PDB-style file with coordinates for d2c8jb_.
(The format of our PDB-style files is described here.)

Timeline for d2c8jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c8ja_