SCOPe 2.08: Domain d2c8ja_: 2c8j A:

Lineage for d2c8ja_ (2c8j A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
   automatically mapped to Pfam PF00762

6. Protein automated matches [190319] (3 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [187522] (1 PDB entry)

8. Domain d2c8ja_: 2c8j A: [163322]
   automated match to d1ak1a_

Details for d2c8ja_

PDB Entry: 2c8j, 2.1 Å

PDB Description: crystal structure of ferrochelatase hemh-1 from bacillus anthracis, str. ames

PDB Compounds: (A:) ferrochelatase 1

SCOPe Domain Sequences for d2c8ja_:

Sequence; same for both SEQRES and ATOM records:

>d2c8ja_ c.92.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
mkkkigllvmaygtpykeedieryythirrgrkpspemledlteryraiggisplatitl
eqakklekrlnevqdeveyhmylglkhiepfiedavkemhndgiqdaialvlaphystfs
vksyvgraqeeaeklgnltihgidswykepkfiqywvdavksiysgmsdaerekavlivs
ahslpekiiamgdpypdqlnetadyiargaevanyavgwqsagntpdpwigpdvqdltre
lnekygytsfvyapvgfvaehlevlydndfeckvvtdeigakyyrpempnasdafidclt
dvvvkkkesvm

Timeline for d2c8ja_:

• d2c8ja_ first appeared in SCOPe 2.01
  
• d2c8ja_ appears in SCOPe 2.07