![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein automated matches [190133] (7 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries) |
![]() | Domain d2c8gd_: 2c8g D: [163317] automated match to d1g24a_ complexed with so4; mutant |
PDB Entry: 2c8g (more details), 2 Å
SCOPe Domain Sequences for d2c8gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8gd_ d.166.1.1 (D:) automated matches {Clostridium botulinum [TaxId: 1491]} ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl nkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhsty hiddmrlssdgkqiiitatmmgtai
Timeline for d2c8gd_: