Lineage for d2c8gb_ (2c8g B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558271Protein automated matches [190133] (6 species)
    not a true protein
  7. 2558290Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries)
  8. 2558307Domain d2c8gb_: 2c8g B: [163315]
    automated match to d1g24a_
    complexed with so4; mutant

Details for d2c8gb_

PDB Entry: 2c8g (more details), 2 Å

PDB Description: structure of the pn loop q182a mutant c3bot1 exoenzyme (free state, crystal form i)
PDB Compounds: (B:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c8gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8gb_ d.166.1.1 (B:) automated matches {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgt

SCOPe Domain Coordinates for d2c8gb_:

Click to download the PDB-style file with coordinates for d2c8gb_.
(The format of our PDB-style files is described here.)

Timeline for d2c8gb_: