Lineage for d2c8fg_ (2c8f G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225847Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1225848Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1225849Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1225992Protein automated matches [190133] (3 species)
    not a true protein
  7. 1225993Species Clostridium botulinum [TaxId:1491] [187018] (8 PDB entries)
  8. 1226019Domain d2c8fg_: 2c8f G: [163313]
    automated match to d1g24a_
    complexed with nad; mutant

Details for d2c8fg_

PDB Entry: 2c8f (more details), 2.5 Å

PDB Description: structure of the artt motif e214n mutant c3bot1 exoenzyme (nad-bound state, crystal form iii)
PDB Compounds: (G:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c8fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8fg_ d.166.1.1 (G:) automated matches {Clostridium botulinum [TaxId: 1491]}
ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlnmllprhsty
hiddmrlssdgkqiiitatmm

SCOPe Domain Coordinates for d2c8fg_:

Click to download the PDB-style file with coordinates for d2c8fg_.
(The format of our PDB-style files is described here.)

Timeline for d2c8fg_: