Lineage for d2c8dc_ (2c8d C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1939880Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1940022Protein automated matches [190133] (5 species)
    not a true protein
  7. 1940039Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries)
  8. 1940061Domain d2c8dc_: 2c8d C: [163306]
    automated match to d1g24a_
    complexed with so4; mutant

Details for d2c8dc_

PDB Entry: 2c8d (more details), 2.2 Å

PDB Description: structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form i)
PDB Compounds: (C:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c8dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8dc_ d.166.1.1 (C:) automated matches {Clostridium botulinum [TaxId: 1491]}
ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhsty
hiddmrlssdgkqiiitatmmgtainpk

SCOPe Domain Coordinates for d2c8dc_:

Click to download the PDB-style file with coordinates for d2c8dc_.
(The format of our PDB-style files is described here.)

Timeline for d2c8dc_: