Lineage for d2c8bx_ (2c8b X:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558271Protein automated matches [190133] (6 species)
    not a true protein
  7. 2558322Species Clostridium botulinum [TaxId:29342] [186934] (1 PDB entry)
  8. 2558323Domain d2c8bx_: 2c8b X: [163299]
    automated match to d1g24a_
    complexed with so4; mutant

Details for d2c8bx_

PDB Entry: 2c8b (more details), 1.7 Å

PDB Description: structure of the artt motif q212a mutant c3bot1 exoenzyme (free state, crystal form ii)
PDB Compounds: (X:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c8bx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8bx_ d.166.1.1 (X:) automated matches {Clostridium botulinum [TaxId: 29342]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhstyh
iddmrlssdgkqiiitatmmg

SCOPe Domain Coordinates for d2c8bx_:

Click to download the PDB-style file with coordinates for d2c8bx_.
(The format of our PDB-style files is described here.)

Timeline for d2c8bx_: