Lineage for d2c81a_ (2c81 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381040Species Bacillus circulans [TaxId:1397] [187516] (2 PDB entries)
  8. 1381041Domain d2c81a_: 2c81 A: [163296]
    automated match to d1b9ha_
    complexed with pmp

Details for d2c81a_

PDB Entry: 2c81 (more details), 1.7 Å

PDB Description: crystal structures of the plp- and pmp-bound forms of btrr, a dual functional aminotransferase involved in butirosin biosynthesis.
PDB Compounds: (A:) glutamine-2-deoxy-scyllo-inosose aminotransferase

SCOPe Domain Sequences for d2c81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c81a_ c.67.1.0 (A:) automated matches {Bacillus circulans [TaxId: 1397]}
wpewpqhsdrtrrkieevfqsnrwaisgywtgeesmerkfakafadfngvpycvpttsgs
talmlalealgigegdevivpsltwiatatavlnvnalpvfvdveadtycidpqliksai
tdktkaiipvhlfgsmanmdeineiaqehnlfviedcaqshgsvwnnqragtigdigafs
cqqgkvltageggiivtknprlfeliqqlradsrvycddsselmhgdmqlvkkgdiqgsn
yclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsrqtyygyv
frfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknrylksvrkte
aywrglhypvserasgqsivihhaillaepshlsllvdavaelarkfcv

SCOPe Domain Coordinates for d2c81a_:

Click to download the PDB-style file with coordinates for d2c81a_.
(The format of our PDB-style files is described here.)

Timeline for d2c81a_: