SCOPe 2.02: Domain d2c7wb_: 2c7w B:

Lineage for d2c7wb_ (2c7w B:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (14 PDB entries)

8. Domain d2c7wb_: 2c7w B: [163295]
   automated match to d1katv_
   complexed with mpd

Details for d2c7wb_

PDB Entry: 2c7w, 2.48 Å

PDB Description: crystal structure of human vascular endothelial growth factor-b: identification of amino acids important for angiogeninc activity

PDB Compounds: (B:) vascular endothelial growth factor b precursor

SCOPe Domain Sequences for d2c7wb_:

Sequence; same for both SEQRES and ATOM records:

>d2c7wb_ g.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecvptg
qhqvrmqilmirypssqlgemsleehsqcecrpkkk

Timeline for d2c7wb_:

• d2c7wb_ first appeared in SCOPe 2.01
  
• d2c7wb_ appears in SCOPe 2.03
  
• d2c7wb_ appears in the current release, SCOPe 2.08