![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
![]() | Protein automated matches [190506] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187459] (37 PDB entries) |
![]() | Domain d2c7wa_: 2c7w A: [163294] automated match to d1katv_ complexed with mpd |
PDB Entry: 2c7w (more details), 2.48 Å
SCOPe Domain Sequences for d2c7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7wa_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvvswidvytratcqprevvvpltvelmgtvakqlvpscvtvqrcggccpddglecvptg qhqvrmqilmirypssqlgemsleehsqcecrpkkk
Timeline for d2c7wa_: