SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2c7lb_ (2c7l B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1978832Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 protein domains)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979007Protein automated matches [190531] (17 species)
    not a true protein
  7. 1979074Species Mastigocladus laminosus [TaxId:83541] [187515] (3 PDB entries)
  8. 1979078Domain d2c7lb_: 2c7l B: [163288]
    automated match to d1i7yb_
    complexed with bla, cyc

Details for d2c7lb_

PDB Entry: 2c7l (more details), 2.85 Å

PDB Description: low temperature structure of phycoerythrocyanin from mastigocladus laminosus
PDB Compounds: (B:) phycoerythrocyanin beta chain

SCOPe Domain Sequences for d2c7lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7lb_ a.1.1.3 (B:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mldafsrvveqadkkgaylsndeinalqaivadsnkrldvvnrltsnassivanayralv
aerpqvfnpggpcfhhrnqaacirdlgfilryvtysvlagdtsvmddrclnglretyqal
gtpgdavasgikkmkeaalkiandpngitkgdcsqlmselasyfdraaaava

SCOPe Domain Coordinates for d2c7lb_:

Click to download the PDB-style file with coordinates for d2c7lb_.
(The format of our PDB-style files is described here.)

Timeline for d2c7lb_: