| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein automated matches [190531] (8 species) not a true protein |
| Species Mastigocladus laminosus [TaxId:83541] [187515] (2 PDB entries) |
| Domain d2c7la_: 2c7l A: [163287] automated match to d1i7ya_ complexed with bla, cyc |
PDB Entry: 2c7l (more details), 2.85 Å
SCOPe Domain Sequences for d2c7la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7la_ a.1.1.3 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
alglspswyiaalefvrdnhgltgdvageantyinyainals
Timeline for d2c7la_: