Lineage for d2c7ef_ (2c7e F:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3045353Fold i.16: GroE chaperon [69998] (1 superfamily)
  4. 3045354Superfamily i.16.1: GroE chaperon [69999] (1 family) (S)
  5. 3045355Family i.16.1.1: GroE chaperon [70000] (1 protein)
  6. 3045356Protein GroE chaperon [70001] (1 species)
  7. 3045357Species Escherichia coli [TaxId:562] [70002] (3 PDB entries)
  8. 3045377Domain d2c7ef_: 2c7e F: [163278]
    Cryo-EM structure of GroEL-ATP complex
    complexed with atp, k, mg

Details for d2c7ef_

PDB Entry: 2c7e (more details), 9.7 Å

PDB Description: revised atomic structure fitting into a groel(d398a)-atp7 cryo-em map (emd 1047)
PDB Compounds: (F:) 60 kda chaperonin

SCOPe Domain Sequences for d2c7ef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7ef_ i.16.1.1 (F:) GroE chaperon {Escherichia coli [TaxId: 562]}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
vaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk

SCOPe Domain Coordinates for d2c7ef_:

Click to download the PDB-style file with coordinates for d2c7ef_.
(The format of our PDB-style files is described here.)

Timeline for d2c7ef_: